Video Contents

Audio
Cameras
Capture Cards
Check List
FAQ
Firewire
Flash Cards
Indexed Powerpoint
Mice
Monitors
MP3
NetMeeting
NetShow
Links
Real
PCMCIA
Powerpoint
Premiere
Projectors
Setup Guide
Tape to ASF
Telephones
To do
Tripods
USB
Vendors
Video decks

December

NetShow

Links

  • Microsoft site
  • NetShow Content Creation Authoring Guide
  • Streaming Media Services FAQ
  • MSDN asx scripting overview
  • MSDN asx elements reference
  • MSDN windows media meta file elements reference
  • PowerPoint 2000
  • microsoft.public.windowsmedia.technologies Newsgroup
  • WMP Mini-FAQ
  • AVI overview Includes technical overview of NetShow
  • Other Berkeley Involvement with Windows Media
  • Powerpoint talks from Design Automation Conference - similar to what is on the GSRC website.
  • ariadne-webdesign ppt 97 web pages
  • CodecCentral
  • icanstream.com
  • Contents

  • Overview
  • Powerpoint 97
  • Window Media Player (WiMP)
  • Streaming
  • Content
  • How To
  • Directory Structure
  • Encoder Setup
  • Audio
  • Tasks
  • Dinner Capture
  • After the capture
  • Updating the website
  • Summary Of Staff Time
  • Bugs
  • Mozilla
  • Overview

    We have been capturing Powerpoint presentations with video, audio and synchronized slide flips since March of 1999.

    The basic idea is that we generate a file that contains the audio and video along with slide flips and then make that file available on the web for later viewing.

    Examples

    To see sample NetShow/Powerpoint talks, you need to be a GSRC Website member. The talks can be found on the Gigascale site under Publications->Talks

    If you are running Microsoft Internet Explorer, you can try looking at Brooks Cutter's ppt2k presentation with video and slide flips This page will not work with Netscape Communicator

    Requirements

  • Most presenters use PowerPoint. We would like to be able to support PowerPoint 2000, but are currently using PowerPoint 97 because of critical design and usability flaws in PowerPoint 2000
  • We need to support both Netscape Communicator and Microsoft Internet Explorer
  • During a capture, it should be very easy to start up the encoder and do the capture. We should have canned setting files and one click start up. Going through a lot of dialog boxes will only cause problems.
  • Postproduction should be kept at a minimum. Ideally, we would like to have the talks available the day after the presentation. Ideally, we would be able to automatically generate HTML and PDF output with out going through lots of dialog boxes for each talk.
  • The HTML page that the user sees should be very configurable so that we can use the GSRC website look and feel.
  • Eventually, we would like to do live broadcasts.
  • Powerpoint97

    has two methods of generating ASF files.
  • 'Publish to ASF' - generates an ASF file with still images and audio only of the presenter.
  • 'Windows Media Presenter' - sends messages over the net from the presenter machine to an encoder machine and generates an ASF file with URL scripts and audio and video of the presenter.
  • Locally, we have used Windows Media Presenter to capture talks.

    Windows Media Presenter requires the NetShow 3.0 or 3.1 encoder or the Windows Media Player 4.1 Encoder, and it can run under NT4.0 workstation or Windows 2000. We have not tested any software under Windows 95 or 98, as those software packages are not operating systems, they are toy single user single tasking software packages from hell.

    Window Media Player (WiMP)

    For an unknown reason Microsoft renamed NetShow to Windows Media sometime after the NetShow 3.0 release WiMP versions can be found at http://support.microsoft.com/support/kb/articles/Q190/9/90.ASP

    In the Windows Media Player (WiMP) that ships with NetShow 3.0 Help->About Windows Media Player shows that it is version 6.01.05.0217

    The WiMP that ships with 4.0beta has a version number of 6.02.05.0410

    The WiMP that ships with 4.1 has a version number of 6.4.05.0809 (Gary's laptop, which was failing)

    6.4.7.1028 WMP 6.4 with multi-bit rate (MBR) updates for Internet Explorer

    The WiMP that a user was having problems with under NT is 6.4.07.1112 - WMP 6.4 with MBR updates (minor error messaging updates from 6.4.7.1028)

    The WiMP that ships with Windows 2000 is 6.4.09.1190 or 4.1.0.3920 (I think) Versions 6.4.9.* WMP 6.4 for Windows 2000 only (cxh's W2k laptop)

    The WiMP v6.4 is not supported under Windows 2000.

    The WiMP 7 beta is 7.00.00.1304. It works under Windows 2000, but not NT. Note that WiMP 7 does not support msbd previewing, but does support html previewing while the encoder is running.

    7.00.00.1956 is another version that has been seen under NT

    In 9/01, the default version was 7.01.00.3055

    5/03: 9.00.00.2980

    Windows Media 7.x and later will not work under NT

    Windows Media SDK 7.1 requires Direct X 6.0 or later.
    When trying to install Windows Media Encoder SDK 7.1, it says

    This application requires DirectX Media 6.0 or higher. Please install the DirectX Media 6.0 or greater run-time from www.microsoft.com/directx. Select Yes to continue and No to abort Setup.

    When trying to install Windows Media Encoder 7:
    Setup has detected an earlier version of the Windows Media Encoder installed on your system. Setup will leave the previous Encoder version installed on your system but will upgrade the program links to reference Windows Media Encoder v7

    When trying to install Windows Media 7 Resource Kit Beta, we get
    Set up has detected that you are running an older operating system. Windows Media Player 7 is supported on Windows 98 and Windows 2000

    It is unclear whether DirectX can run under NT
    Info about DirectX 8.0 and Windows NT: http://thetechnozone.com/pcbuyersguide/software/system/DirectX8.html
    Although DirectX 6.1 was officially only for Windows 95/98, some testers found that it could also be coerced to install under Windows NT 4.0, with some limitations. (Standard disclaimers apply.)

    Windows Media Encoder 9

    I installed Windows Media Encoder 9 under Windows 2000, but when I try to connect, I get
    There was a problem start the Windwos Media Encoder
    Class not registered 80030154

    Streaming

    If we download a .asf file to IE 5, then the file starts streaming automatically. If we download a .asf file to Netscape Communicator 4.51, then the file is first downloaded, and then displayed.

    Linking to an .asx file will cause Netscape to stream.

    <ASX Version = "3.0">
    <Entry>
    	<Ref href ="http://10.0.0.1/gsrc/talks/2000/losangeles/01/01.asf" />
    </entry>
    </ASX>
    
    However, viewing a .asx file from a machine running the Apache server will not work until the .asx type is associated with the the proper application.

    "Setting MIME Types on Web Servers for Use with NetShow" at http://support.microsoft.com/support/kb/articles/q189/4/04.asp suggests adding

    AddType video/x-ms-asf asf asx
    
    to srm.conf and restarting the httpd servers

    One potential issue is that documentation says that under NT, the .asx file should have CRNL line termination. However, when streaming from Apache under Solaris, the file should have newlines only (use dos2unix to convert)

    The primary differences between using Apache and Microsoft IIS with the Netshow Server to serve .asf files:

  • .asf files served from IIS/Netshow have the fast forward and rewind buttons enabled
  • IIS/Netshow has the total time of the clip
  • Content

    Windows Media On-Demand Producer Can be used to convert WAV and AVI files to ASF files.

    How To

    The following laptops are used:
  • 10.0.0.1 - The Encoder - IBM 600 on the dock, connected to the video cameras
  • IBM 600 Laptop 300Mhz, 128Mb memory, 6 gig disk PN 2645-85U
    Any good laptop with the PCI card (PCI card, not PCMCIA card) expansion capability should work. We chose laptops for portability reasons. Another way to do it would be to get a small powerful PC and put a flatscreen monitor on it and put it in a flight case.

    This model laptop is no longer sold, but a top of the line IBM 600 with spare power supplies and batteries are about $4000 ea

  • IBM SelectaBase 600 12J2467 $189
  • IBM SelectaDock III 3547003 $695
  • Winnov Videum AV (PCI) Video Capture Card $199 - http://www.winnov.com Any good video capture card would work.
  • The encoder machine needs the following software
  • The Windows Media Player 6.4 and the Windows Media Tools 4.1 available from http://ptolemy.eecs.berkeley.edu/~cxh/sa/nt/dists/netshow
    If you can't find Windows Media Tools 4.1, try using Google to search for wmtools.exe. Below are some sizes
    Windows Media Tools 4.0-beta wmtools.exe 4413936 bytes, 4311 Kb
    Windows Media Tools 4.1 wmtools.exe 4084904 bytes, 3990 Kb

    When you install Windows Media Tools 4.1, you will be prompted to install either the entire tool set or just the PowerPoint Add-In. On the encoder machine, do a complete installation. On the presenter machine, you can install just the PowerPoint Add-In.
  • Powerpoint 97 to do slide conversions and set up. When installing Powerpoint 97, be sure to select Web Page Authoring (HTML) so that you can convert the slides.
    Note that Powerpoint 97 is required, Powerpoint 2000 will not work here. Powerpoint 97 must be installed on the presenter machine and usually is installed on the encoder machine so that the slide conversion can occur.
  • The IIS Personal Web Server, available as part of the Microsoft Windows NT 4.0 Option Pack, which is available locally as: \\ntsww\newsww\windows_nt\option_pak or on the web at http://www.microsoft.com/ntworkstation/downloads /Recommended/ServicePacks/NT4OptPk/License.asp
  • PCAnywhere to control the presenter PC. (NOTE: pcAnywhere version 9.0 doesn't run on Windows 2000 and must be updated to version 9.2. To upgrade you may either download the patch "921UP.EXE" and run the executable from within the pcAnywhere directory or while online with a speedy connection select "Live Update" from the pcAnywhere section of the Start Menu.
  • 10.0.0.2 - The Presentation machine - IBM 600 labtop, but could be anything.
  • A wireless mouse is useful. We use the logitech mouse. See the Mouse page for details $50?
  • Also, provide the presenter with a laser pointer
  • The advantage of having all the laptops be the same is that it makes it easier to provide spares.
    The user runs their slides from this machine. The partitions on the presentation and monitor machines that contain the slides should be available as shortcuts on the desktop.
  • Powerpoint 97 to display the slides
  • The Windows Media Tools 4.1 which includes the PowerPoint presenter Add-in.
    On the presenter machine, you can install just the PowerPoint Add-In, you need not do a complete installation of Windows Media Tools 4.01
  • The Windows Media Player 6.4
  • PCAnywhere so that another PC can control the Presentation machine
  • 10.0.0.3 - The Monitor machine - IBM 600, again, could be anything.
    Used to generate gifs from Powerpoint slides and to check the broadcasts. Ideally, this machine is also set up to do the encoding in case something happens to either the encoder or the presentation machine. This machine should also have the a local copy of the slides so that if the encoder machine crashes, the slides are still available.
  • Powerpoint 97 to display the slides
  • Adobe Acrobat to convert the slides to pdf.  (Note that this can be done after the presentation).
  • The Windows Media Tools 4.1 which includes the Powerpoint presenter plugin
  • The Windows Media Player 6.4
  • PCAnywhere to control the Presentation machine.
  • Below is a list of the software:
  • Winnov Videum video grabber software - comes with the hardware, upgrades available at http://www.winnov.com
  • Microsoft Media Technnology 4.1 Tools - Currently a free download
    http://www.microsoft.com/windows/windowsmedia/en/download/default.asp Get the Player and the Windows Media Tools, which will include the PowerPoint 97 Plugin and the encoder.
    (Help->About Windows Media Encoder yields 4.1.0.3920)
  • Cygwin scripting tools
    Currently, we are using version b20.1, which is a free download
    There are two versions of Cygwin tools: The user version and the full version. The User version might work, but I would go with the full version, disk space is cheap. The Full version includes make, but the User version does not
    Get the full versionftp://go.cygnus.com/pub/sourceware.cygnus.com/cygwin/cygwin-b20/full.exe
    Follow the instructions in readme.txt
  • Microsoft Windows NT, Office and IIS Web Server - Free to Universities, probably costs less than $1k? The IIS webserver is necessary, otherwise the ffwd/rew buttons do not work.
  • 2 copies PC Anywhere - $150 ea
  • Note that a complete set of spares should be available:

  • 2 power supplies
  • 2 PCMCIA network cards with cables
  • 2 Floppy drives
  • Figure the total cost of hardware to be $12k for three laptops + $1100 for dock and video card Each machine has a gsrc account with a the same password, and the environment is set up so that the common tools are quickly available in the start menu to minimize fumbling. Also, each machine should be set to start up the appropriate programs automatically.

    We use the following network gear

  • 1 4 port 100Mb hub $150
  • 3 short Cat5 cables $75
  • 1 100' Cat5 cable (to reach the podium) Wireless might work, but it would be one more thing to go wrong. $100
  • We use the following video gear

  • 2 Canon VC-C3 Cameras, ~$1000 ea. (Cameras Page)
  • We purchased a CP-ITV-VC3 camera controller with a joy stick that can control 4 cameras. The remote control is necessary because the IR remote does not work if the camera is far away. $750
  • An alternative to the camera controller is to run a serial cable from the far camera to the laptop and run camera controller software. To do this, one will need a 100' db9 connector. We used a 100' cat 5 cable with two rj/db9 adapters $100
  • S-video switcher ~$400
  • Two tripods from http://www.bhphotovideo.com/ For more information, see the Tripods page - ~$370 total
  • 2 - Tripod Bag 35" [89cm] (3280) Item # BO3280...36.95
  • 2 - Convertible Tripod (3021) Item # BO3021...98.95 Same construction as Model #3021S. It has a maximum shooting height of 71". The adjustable spread of the legs combined with telescoping convertible center post lets you get as low as 101/4".
  • 2 - 3 Way Pan Tilt Head with Quick Release (3030) Item # BO3030...48.50
  • 1 - 6', 1-25', 1-50', 1-100' high quality S-video cables $200?
  • (optional) Cheap room camera on the podium for variety $100
  • (optional) 100' coax cable with BNC connectors and BNC-RCA connectors for cheap room cam $100
  • Miscellaneous

  • Lots and lots of batteries. Replace the wireless batteries first every break. Replace everything first thing in the morning
  • Box of misc. audio adapters for RCA, 1/4", BNC, mini etc.
  • Duct tape or gaffer's tape for taping cables down
  • Small flashlights for looking into the back of the audio gear
  • Tool set (screwdrivers, wire strippers, needlenose pliers)
  • velcro cable ties for wrapping cables - Don't use wire twist ties, it is a good way to blow up gear.
  • Lots of AC extension cords and power strips
  • Flight cases for gear. We did one show with two flight cases and a case for the audio. If the cases are less than 70lbs, they can be checked on an airplane. Laptops, camera, and projectors should be hand carried.
  • The Audio equipment is listed separately

    Directory Structure

    On the Encoder machine, the website is in d:\\Inetpub\\wwwroot

    The talks for a workshop should go into a subdirectory: d:\\Inetpub\\wwwroot\\gsrc\\pubs\\talk\\four_digit_year\\city_name. For example: d:\\Inetpub\\wwwroot\\gsrc\\pubs\\talk\\2000\\losangeles.

    The directory d:\\Inetpub\\wwwroot\\gsrc on the encoder machine should be shared as wwwrootgsrc so that the presentation machine can access the Powerpoint file

    Each workshop directory contains the following files:

    about.htm
    Notes about the capture process.
    lib/default.css
    Default stylesheet
    lib/empty.htm
    Initial blank slide shown by individual talks.
    lib/footer.htm
    The footer that is displayed on each of the indivdual talk pages. This file is different for each workshop.
    makefile
    contains a rule that creates index.html by running mkallasx.sh
    mkallasx.sh
    Shell script that calls mkasx.sh for each talk and generates index.html
    mkallpptdirs.sh
    Shell script that creates the initial empty individual talk directories by calling mkpptdir.sh
    mkasx.sh
    Shell script that generates contents of the individual talk directories.
    mkpptdir.sh
    Shell script that creates the contents of one initial empty individual talk directory. This script uses templates from the template directory in the current workshop directory.

    Each talk should go into a separate subdirectory of the workshop directory. The talk directories are numeric, starting with 01

    Each talk directory NN will have the following files:

    NN.ppt
    The Powerpoint slides provided by the speaker
    NN.asd
    Generated by the Windows Media Encoder program. This file contains the configuration for the Windows Media Encoder, including the location where the .asf file should be created.
    NN.nse
    Windows Media Encoder settings. Generated by Powerpoint before the talk starts.
    NN.asf
    Generated by the encoder while the presentation is being run.
    NN directory
    Contains the html version of the ppt file
    Generated by Powerpoint 97 save as html
    SlideXX.gif
    One file per slide. It is best if these are generated by Powerpoint before the talk starts so that the talk can be viewed in realtime by the conversion and checking laptop. However, it is not required that these files be present at recording time
    How to set up the directory structure:
    1. On the encoder machine, log in as the gsrc user and check out the gigavaultwww CVS Repository
      cd d:/inetpub/wwwroot
      cvs -d :ext:gigasource.eecs.berkeley.edu:/home/cvs co gigavaultwww
      mv gigavaultwww gsrc
      
    2. Create a new directory for the workshop
      cd d:/inetpub/wwwroot/gsrc/talks/year
      mkdir city
      cvs add city
      
    3. Populate the workshop directory with scripts necessary to build the indivdual talk directories by copying from the last talk
      cp lastcity/* city
      mkdir city/lib
      cp lastcity/lib/* city/lib
      
    4. Check the files back in
      cd city
      cvs add lib lib/*.htm lib/*.css *.htm *.sh makefile
      cvs commit -m "Added initial setup for city"
      
    5. Mount //gigavault with Start->run and then copy over the template directory from the last talk
      cp -r //gigavault/wwwroot/gsrc/talks/2000/lastcity/template/ city
      
    6. Open up city/template/template.ppt and update the settings
      1. Click on Tools->Windows Media Presenter->Presenter Settings And then browse to city/template/template.nse and click OK
      2. Click on Tools->Windows Media Presenter->Edit Windows Media Encoder Settings File and Click on city/template/template.nse See the Netshow Encoder File section for the appropriate settings
      3. Click on File->Save
      4. Important: Because of an apparent bug in Powerpoint 97, you must actually Exit Powerpoint between editing files or else your settings will not be properly saved.
    7. Connect the laptop to the video card and run the Windows Media Encoder and update template/template.asd. See the ASD File section below.
    8. Run ./mkallpptdirs.sh
    9. Go throught each of the directories and verify that the settings for the powerpoint file and the asd file are correct. You will have to change the path to each individual talk directory.

    Encoder Setup

    1. The audio input should be plugged into the aux jack (mini plug nearest the RCA)
    2. Start up Winnov audio mixer (Start ->Winnove Videum NT -> Utilities ->Videum Audio Mixer) and select the aux input, which looks like a CD. You should see audio signal on the meter
    3. Start up Windows Media Encoder and set up the .asd files. Each talk should have a .asd file. The only difference between the .asd files for two talks will be the local ASF File setting.
      1. Go to Encoding -> Properties -> Template
      2. Select 100 Presentation Video with Scripts which will use the following settings
        Audio Codec: ACELP.net
        Audio Format: 8.5kbits/sec 8khz Mono
        Video Codec: MS MPEG4-V2
        Video Rate: 15 fps	
        Capture Image Dimension: 320x240
        Video Quality: 60%
        Seconds/Iframe: 10
        
        Note: If you use the
        ACELP codec, then you will avoid this metallic clank. The way to hear this clank, is to connect to a running encoder via the msbd port (for example msbd://10.0.0.1/:1000)

        Avoid the default Windows Media Audio V2 encoder

        http://support.microsoft.com/default.aspx ?scid=%2fsupport%2fmediaplayer%2fwmptest%2fwmptest.asp says

        ACELP audio codec is a version of the Algebraic-Code-Excited Linear Prediction (ACELP) compression methodologies that have been optimized for use on Internet Protocol (IP) networks and the Intel Pentium platform. Using the ACELP net-adapted packetization method, it is able to minimize the impact of errors and significantly improve the error correction possibilities in case of data-packet loss. This codec uses frame concatenation and interlacing to more efficiently encode data. In Windows Media Encoder, ACELP.net can be used to compress audio to bandwidths ranging from 5 Kbps to 16 Kbps. This codec is most useful for encoding low bit-rate voice content.

        OLD (bad link) For a discussion of the different codecs, see http://www.microsoft.com/windows/windowsmedia/features/compression/default.asp or start up the Windows Media Player and go to File->Properties-Advanced->Select the audio codec->More information
        The website says:

        Voice Codec: ACELP

      3. Specially designed for compressing the human voice to produce high quality wide-band audio at very low bit rates.
      4. Supports bit rates from 5 Kbps to 16 Kbps.
      5. Developed by Sipro Lab Telecom.
      6. BTW - one cool thing about the Windows Media Audio V2 encoder is that the Windows Media Player does have a spectral display tool under View -> Settings -> Windows Media Audio Decoder. This tool can be useful for debugging the audio levels

      7. The Input tab of the properties field should look like
      8. Live Source is checked
      9. Custom in Audio Capture should be set to Winnov Videum Wave Record
      10. Custom in Video Capture should be set to Winnov Video Capture
      11. AVI/WAV/MP3 File is not checked
      12. The Output tab of the properties field should look like
      13. The To Netshow Server(s) over a network box should be checked
      14. The Allow Remote Server(s) to connect via a fixed port should be checked
      15. MSBD on Port is checked by default. Usually this is 7007
      16. HTTP on Port can be check, it does not seem to matter
      17. Initiate connectino to a NetShow Station Manager is not checked
      18. The To a local ASF File should be checked The file name is usually a file on the webserver, which is in d:\\Inetpub\wwwroot. Note that each talk should be in a separate directory.
      19. Automatic Indexing should be checked
      20. Save the .asd file.
    4. You may want to preview your signal at this point.

    Audio

    Audio is fairly tricky to get right.
  • Individual speakers have lots of dynamic range.
  • Getting audience questions is difficult
  • Gear:
  • Nady XR-82 UHF Dual Receiver 2 channel diversity ($1600?) - Note that these mics eat batteries, exchange batteries every 90-120 minutes (first thing, morning break, lunch, afternoon break, right before dinner speaker)
    We bought Shure T1 Body pack wireless mic with a T4V Diversity with XLR out, but we were not that happy with the audio ($400?)
  • 2 AKG room mics (for audience questions) $300 ea
  • 2 Mic stands $100? ea
  • XLR cables in various lengths, up to 100' $200
  • 2 DBX 166xl compressor gates (two channels for wireless mics, two for room mics) $330 ea
  • Mackie 1402-VLZ Pro mixer. This mixer has sliders, which are easier than knobs to use all day. $629
  • 1402-VLZ User's Manual: remote - local
  • Winnov capture card (also mentioned above)
  • $3989 Total

    There are lots of gain controls to be set:

    Shure gain -> Mackie trim ->Mackie channel slider -> dbx -|
                                                              |
     ----------------------------------------------------------
     |
     |-> dbx -> Mackie master -> Winnov card -> Videum Audio Mixer
    
    

    Audio notes

  • See the Video FAQ for information about setting up the dbx boxes
  • Set the levels by following the instructions in the front of the Mackie manual.
  • Mic-ing the audience is critical for capturing the give and take aspect of the workshop. If you are using sound reinforcement, then turn down the house when you turn up the room mics
  • Test the capture process by connecting to the msbd port
  • Test the results by playing the .asf file on a set of cheap Altec Lansing speakers
  • Tasks

    Before the talk: Things to check

  • Make sure you have plenty of diskspace. Two days of talks usually takes about 450Mb, figure 1Mb/minute for a 100kbps single bitrate stream.
  • Turn off presentation mode on the laptops so that the machines will not blank their screens
  • Before the talk: Powerpoint Conversion

    Note that if you are short on time, you can skip converting the slides and do it after the talk. Converting while encoding has caused problems in the past with the encoder, so you may want to avoid doing this.
    1. On the presentation machine, or on another machine that has the Powerpoint 97 Windows Media plugin, for each talk, open the .pptfile and then do Tools->Windows Media Presenter->Export Slides.
      Typically, the Powerpoint file should be in the same directory on the web server as the other files, which would be: \\10.0.0.1\\wwwrootgsrc\\talks\\year\\city\\talknumber\\talknumber.ppt

      The slides should be exported to a partition that is mounted on the encoder machine. Typically, this would be \\10.0.0.1\\wwwrootgsrc\\talks\\year\\city\\talknumber

      Currently, we are exporting the slides as gifs so that they are not lossy.

      We use the default settings for size: 480x360

      Regina Pistilli writes

      Occasionally, I have had problems with complex slides exporting from PPT. Then I use SangIt on the slide that doesn't export; delete all the info on the troubled slide in PPT and re-export; finally replace the blank GIF with the SangIt file.

      The standard size for GSRC and DAC is 480wide x 360 height GIFs.
      We use GIFs instead of jpegs because GIFs are lossless. It would be nice if we could export PNG

    2. Each talk should have a The Netshow Encoder File (.nse). This file can be created ahead of time.
      To create this file, start Powerpoint, go to Tools->Windows Media Presenter->New Windows Media Encoder Settings File
      (Or, you can copy a .nse file from another page, and change just the Base URL)
      The dialog box should look like
    3. Encoder: the name or IP address of the Encoder. (10.0.0.1)
    4. Base URL: "This is the URL for the location of the slides on the IIS Server. The BaseURL is important because when you move from slide to slide in the presentation, Windows Media Presenter appends the name of each image to the URL, and then sends this URL as a script command to the client"
      We used to set Base URL to something like http://10.0.0.1/gsrc/talks/2000/city/talknumber/talknumber
      (Note that the
      talknumber/talknumber is repeated.)
      However, this requires having the html page include javascript that does not work very well under Netscape.
      A better solution is to leave this blank, which will use the current directory.
    5. We export slides as gifs so that they are lossless, so for Image Format:, select GIF
    6. Ignore Errors from Netshow Encoder should be checked
    7. Connect to a running Netshow Encoder should be checked
    8. Reconfigure using ASD File should be not be checked.
      It is fairly easy to overwrite the .asf file from the previous talk. So, each time the server is configured, we reconfigure it with a new .asd file.
    9. There should be a different .asd file for each talk. Each .asd file should have a separate output .asf file. These files are generated using the encoder on the presentation machine by using Save As.

      The asd file is accessed remotely from the presentation machine, so the file should be named something like \\\\10.0.0.1\wwwgsrcroot\talks\2000\city\talknumber

    10. Use this configuration with current slide show should be checked
    11. On the presentation machine, go to Tools->Windows Media Presenter->Presenter Settings and enter in the path to the .nse file. This might be: \\10.0.0.1\\wwwrootgsrc\\talknumber\\talknumber.nse
      Also, check the Use Netshow Encoder during the slide show box. You might want to uncheck this if the author wants to test slides
    12. Save the Powerpoint file

    Right before the first talk

    1. Replace batteries on wireless mouse, wireless mics, laser pointers
    2. Check laser pointers
    3. Start the video tape back up rolling.

    Right before the talk

    1. Watch the sound levels on the Mackey and the Videum Audio Mixer
    2. Start up PowerPoint for the speaker, and open up their slides, which should be in \\10.0.0.1\wwwrootgsrc\talks\year\city
    3. Go to Tools->Windows Media Presenter->Presenter Settings and select Use Windows Encoder during the slide show
      Note that even if you save the .ppt file with this set, when you bring it up, it will not be set.

    At the start of the talk

    One person can operate the encoder, and one person can operate the presenter via PCAnywhere
    1. Stop, then exit the encoder from the previous talk
    2. Copy the .asf from the previous talk to a safe place
    3. On the encoder machine, start up the encoder by clicking on the .asd file.
    4. On the encoder machine, start up the encoder by pressing the play button (small triangle, like a tape deck)
    5. If possible, blank the projector so that the audience is not distracted by the setup process on the presentation machine.
    6. On the presenter machine via PCAnywhere, go to the powerpoint file open it, goto Tools->Windows Media Presenter->Presenter Settings and select Use Windows Media Encoder during the slide show, check the other settings, then wait until the encoder is running and start the slide show with Alt-d-v.

    During the talk

    1. Watch the soundlevels on both the Mackey Mixer and the Winnov Audio mixer. The Winnov vu meter on the should rarely reach the red. Usually, each time the meter hits the red, then the audio output of the encoded stream will click because of clipping.
    2. You can monitor the talk via the web from a third machine.
      The encoder will display two addresses like
    3. msbd:///10.0.0.1:7007
    4. http:///10.0.0.1:1041
    5. Verify that the video tape deck is rolling

    During a break or lunch

    1. Back up the previous .asf files
    2. Swap 9v batteries in the wireless mikes
    3. Swap tapes in the tape deck
    4. Set up for the next talk and start the encoder early - we have had many problems starting the first talk, it is easier to cut out 10 minutes of kruft than it is to reboot at the last minute
    5. Check out the .ppt and .asd files for the next section.
    6. Be sure that there is enough disk space (figure 1mb/minute)
    7. Take slides from speakers

    Dinner Capture

    At the GSRC Workshops, we occaisionally capture a dinner presentation.  Most dinner speakers use transparencies generated from Powerpoint files.  Often, the ppt file is only available after the presentation.  To capture these presentations, the trick is to create a large talk with 50 empty pages and then follow along with the speaker and advance the slides on the presentation machine.

    The Dinner Capture setup consists of a subset of the regular setup - we use only the encoder, the presentation machine and the wireless mic.

    • IBM 600 Base with PCI Video Card and powercable
    • Encoder Laptop with ethernet card
    • Presentation Laptop with ethernet card and A/C Adapter
    • Wireless mouse
    • Crossover Cat5 ethernet cable
    • Optional: ethernet hub, powersupply and 10' and 50' ethernet cables
    • Wireless Shure Mic + basestation
    • Optional: small mackie, XLR M/F cable, head phones
    • 1/4" mono/mini plug
    • Spare batteries 9V, AA, AAA
    • Video Camera + power supply + remote 
    • Tripod
    • SVideo cable
    • Laser pointer
    • XGA Projector + vga cable
    • Optional: Overhead projector
    • Two long extension cords (overhead projector + recording setup)
    • Plug Strip
    • Duct Tape.

    After the capture

    1. For each presentation
    2. Use the ASF Indexer to truncate the start of the talk, and add a Script Event for the first slide.
      Under Windows Media Tools 7(?) use the ASF Indexer, under Windows Media Player 9 Series, install the Encoder, and use Start -> All Programs -> Windows Media -> Utilities -> Windows Media File Editor
    3. generate slide GIFS
    4. Use PowerPoint 97 to save as HTML - make sure the html works under IE and Netscape.

      With ppt2k and Netscape 4.7, do not use dhtml - it will not work with Netscape

      The 'save as' option under ppt2k is somewhat broken.

      There is a menu choice to save as html in a format that is compatible with Netscape 3.0 and later. This menu choice produces dhtml that does not work with Netscape 4.7, in particular, the slides look like hell, the GSRC logo at the top is present twice, and there are other problems.

      There are three menu choices, which go something like:

    5. IE5
    6. IE4 and Netscape3 and later
    7. all other browsers
    8. Choose the 'all other browsers' menu choice
    9. Generate PDFs (2 up). Generating PDF requires Adobe Acrobat and having the PDF printer setup.
    10. Edit the following files:
      mkallasx.sh
      Add each talk to this file
      mkasx.sh
      change the paths from the previous workshop to the current workshop, and update the title.
      lib/footer.htm
      Update the name of the workshop
    11. Split up any asf files that contain multiple talks.
      There are two ways to do this:
    12. Have each subtalk be in a submenu of the main talk
    13. Have each subtalk be at the same level as the rest of the talks.
    14. To have each subtalk be in a submenu, modify mkallasx.sh so that the call to mkasx includes the optional 4th level argument:
      ./mkasx.sh 12c/12c.asf "subtalk" "subtalk author" 1
      	
      To have each subtalk be in its own menu, don't use the optional 4th argument
      ./mkasx.sh 12c/12c.asf "subtalk" "subtalk author"
      	
      No matter how the talks are displayed, for each subtalk, do the following:
      1. Create subdirectories for each talk.
        If the asf file is called 12.asf and it contains 3 subtalks, then create three subdirectories
        	mkdir 12a 12b 12c
        
      2. Copy the master asf file to each subdirectory
        	cp 12/12.asf 12/12a.asf
        	cp 12/12.asf 12/12b.asf
        	cp 12/12.asf 12/12c.asf
        
      3. Use the asf indexer to truncate each talk
      4. Copy the powerpoint file to each subdirectory
        	cp 12/12.ppt 12/12a.ppt
        	cp 12/12.ppt 12/12b.ppt
        	cp 12/12.ppt 12/12c.ppt
        
      5. Truncate the ppt file and save it as html and pdf
    15. Run make. If, when running make you receive the following error:
      bash-2.02$./mkallasx.sh > index.html
      ./mkallasx.sh: not found
      make: *** [all] Error 127
      bash-2.02$
      
      then you need to verify that /bin/sh.exe exists in your current directory structure. If it does not then you will need to do the following which is basically copying bash.exe into /bin and renaming it sh.exe:
      bash-202$ type bash
      bash-202$ <cygwin-b20/H-i586-cygwin32/bin/bash.exe /bin/sh.exe
      bash-202$ make
      

      How make works: When you type

      make
      
      the make.exe executable looks for a makefile and then runs the first rule it finds, in this case the all: rule

      In this case

      make
      
      and
      make all 
      
      do the same thing, which is run the all: rule.

      The all: rule executes the command:

      ./mkallasx.sh > index.html
      
      which runs the mkallasx.sh shell script and puts the output of that script into the index.html file.

    16. Place the ASF files in the asfroot directory in order that they function properly.
    17. Check the files under both IE and Netscape. Ideally, we should also from a machine outside of the eecs domain.

    Updating the website

    If you are using XP. You can use remote desktop connection(Terminal Service to connect Gigavault.

    Click Start->All Programs -> Accessories -> Communication ->Remote Desktop Connection.

    Enter Gigavault.eecs.berkeley.edu as the host you wish to connect to.

    1. Update http://www.gigascale.org/pubs/talks/ by editing gsrcwww/pubs/talks/index.htm in the gsrcwww cvs repository and adding the new workshop
    2. Update http://www.gigascale.org/ by editing php/index.php3 in the php cvs repository and adding the new workshop under News. Remove the reference to the recent workshop in the past
    3. Update http://www.gigascale.org/calendar/workshops/ so that the recent workshop is mentioned in the 'Recent Workshops' section.
      For information about changing this file, see How do I author About, Calendar and People?

    Summary Of Staff Time

    Before the workshop:
    Optional site visit 4hrs
    Planning meetings
    (4 people, 1.5 hrs)
    6hrs
    Purchasing of misc gear
    (batteries, what ever we broke last time)
    4hrs
    2 dry runs
    (4 people, 3 hrs)
    12hrs
    Set up the day before (4 people 3 hours) 12hrs
    The 1st day:
    To record a 9am talk, we start at 6:30am, and often work through lunch until 5:30 (4 people, 11 hours)
    44hrs
    The second day:
    Start later, spend an hour tearing down (4 people, 11 hours)
    44hrs
    Postproduction cleanup 10hrs
    Total 148hrs
    The crew consists of
    1 Programmer/Analyst I Driver, Audio advice, setup/tear down
    1 Programmer/Analyst III Runs Audio board
    1 Programmer/Analyst III Runs Video capture
    1 Programmer/Analyst IV Prepares talks, provides breaks, troubleshooting.

    I think it could be done with 3 people, but 4 makes it easier.

    Bugs

    1. A couple of debugging hints

      In Netscape, if you type in javascript: into the Location entry widget at the top, then you will be able to view any javascript errors.

      If you right click on the video widget, there should be an errors menu choice that will show you errors like the URL that the video widget was trying to open

    2. After installing Netshow 3.0, then 4.0 and then downgrading to 3.0, we were not able to run the MPEG-4 encoder, the error message was Video compressor failed to start. This message comes from /Program Files/NetShow Services/Tools/NsRex.exe. The problem was that /WINNT/System32/mpg4c32.dll was updated with the 4.0 installation. The fix was to copy that file from a 3.0 installation.
    3. When I watch a presentation on a 760XD, the video is blurry. This is a know problem with some video drivers.
      The fix is to start up the Windows Media Player and go to File>Properties>Advanced, and then select Video Renderer in Filters in use and hit Properties. In the Filter Properties window, select the DirectDraw tab and then unselect YUV Flipping
    4. The user needs to go to Tools->Windows Media Presenter->Presenter Settings and select Use Netshow Encoder during the slide show We should figure out a way to avoid this, PC Anywhere helps here.
    5. What happens if the URLS to the slides need to be moved?

      The problem is that when we recorded the GSRC April 99 offsite with the Powerpoint 97 plugin, we used an absolute URL to encode the slides. We did this so that we could view the asf as the talk was being recorded to be sure that everything was working.

      We thought that we would be able to change the URLs later, but the problem is that the script commands that do the URL flips are encoded in the stream, and the Windows Media Tools ASF Indexer associated with older versions of Windows Media does not operate on the stream, instead it operates on script commands at the front of the file. Unfortunately, there is no easy way to get at these commands

      The fix was to use scripting events to catch the slide flips and rewrite them. The way this is done is that the javascript code has a regular expression that matches the bad URL and substitutes in a new, correct URL.

      Sometimes, one asf file will have incorrect urls. For example 10.asf and 11.asf might both refer to gifs in the same directory, even though these are different talks. The fix is to modify the IE and Netscape javascript files for one of the talks so that the proper URL is substituted in.

    6. What happens if you don't have any slide flips at all?

      If the primary encoder fails and you are working from the backup encoder or a video tape, then the asf stream will not have any slide flips at all.

      If this is the case, then you need to play the problem .asf file and write down the times of each slide flip. Then add these to the asf file using the Windows Media ASF Indexer found at (Start -> Program -> Windows Media -> Windows Media ASF Indexer)
      Under Windows Media Tools 7(?) use the ASF Indexer, under Windows Media Player 9 Series, install the Encoder, and use Start -> All Programs -> Windows Media -> Utilities -> Windows Media File Editor

      Windows Media ASF Indexer instructions

      1. Start up the Windows Media ASF Indexer or the
      2. Open an existing .asf file that has the proper slide flips. (Starting from an existing file makes it easier to get the format right)
      3. Export the script file for the working asf file with File->Export Script File
      4. Edit that file and add your slide flips for the problem asf file. You may want to change the Title etc.
      5. Open up the problem .asf file
      6. Import the script file with File -> Import from Script file
      7. Play the .asf file and be sure that the flips happen after the presenter presses the button. Note that there can be timing issues around the key frames and the delays.

      Windows Media File Editor Instructions

      Under Windows Media Player 9 Encoder Start -> All Programs -> Windows Media -> Utilities -> Windows Media File Editor
      1. Copy the .asf file to the local machine - everything will be faster
      2. Open the .asf file
      3. During the capture, the encoder records the slide flips as events in the body of the file. To operate on the script events, the events have to be moved from the body of the asf file to the header.
        Move the Script to the header: File -?> Move Scripts to Header
      4. Part of moving the scripts to the header requires that you save the file
      5. Export the header: File -> Export header file
      6. The resulting header file has double wide characters, so don't open it with Emacs, open it with Notepad and substitute the proper urls. Inside Notepad, I did
        1. Edit -> Replace
        2. Find what: http://10.0.0.1/gsrc
        3. Replace with: http://www.gigascale.org/pubs
        4. Replace All
        5. Save and exit
      7. In Windows Media File Editor, reimport the new script: File -> import header file
      8. Unfortunately, there is a bug. Even though the header file has <RemoveAllMarkers /> <RemoveAllScripts</> the previous script flips remain. The fix is to hit the Script Commands button and remove the old http://10.0.0.1 script events
      9. Save the file
      10. Copy it back up to the server - be sure to save the old file on the server
    7. If you try to play back a .asf file, and you get an unknown error in the Windows Media Player, then try upgrading the Windows Media Player
    8. The Nady mics eat batteries - replace them in the morning, at the morning break, at lunch, at the afternoon break.
    9. The Windows Media Audio V2 encoder does not sound good with voice, use the ACELP encoder instead.
    10. If the .ppt file is large then you may want to copy it from the encoder machine to the presenter laptop so that the start up time is faster.

    9/01

    To buy
  • Do we need a lecturn
  • VGA gender benders 2 FF 2 MM
  • Short xlr cables
  • xlr male/male gender benders
  • Soundstation pelican case
  • More cases
  • Problems
  • Network was slow:
  • Use ip addresses, do not use names
  • The encoder has a 10Mb ethernet card
  • Copy large talks to the presenter laptops
  • We did not start the video deck
  • 11b talk had the wrong urls
  • Mozilla 1.1/Netscape 7 and Windows Media Player (11/02)

    The problem is that Under Mozilla 1.1/Netscape 7, the slides in the video do not flip.

    Under Netscape 4.x, we use the NPDS.npDSEvtObsProxy applet to register a call back so that each time we get a slide flip in the stream, we can adjust the URL.

    Initially, the problem was that a message about obsApp not being inited showed up in the status area. One fix to this was to copy c:/Program Files/Windows Media Player/npds.zip to c:/Program Files/java/j2re1.4.1/lib/ext/npds.zip However, npds.zip extends netscape.plugin.Plugin, which is part of LiveConnect, which is present in Netscape4.x, but not Netscape 6,7 or Mozilla 1.1, so this fix does not really solve the problem.

    Between Netscape 4.x and Mozilla 1.1, the plug-in technology changed, see http://mozilla.org/projects/plugins/scripting-plugins.html

    Real.com overview of embedding viewers: http://service.real.com/help/library/guides/realonescripting/browse/htmfiles/embedint.htm
    Perhaps one solution would be to have Netscape 7 users install the Premium version of Real One that will read asf files?
    http://www.expressresponse.com/cgi-bin/progsnp/real_rec/srchjnnp?search_type=fdocument &search_input=rap01741updv.html&session_id=1037911291.27375.8&template= says that the Premium Version supports .asf files
    Unfortunately, the Premium Version of Real is $5.95/month.

    See the Mozilla Plugin doc at http://plugindoc.mozdev.org/
    and a description of the Windows Media Player Plugin and Mozilla at: http://plugindoc.mozdev.org/wmpwin.html
    and a description of where Mozilla looks for plugins at http://plugindoc.mozdev.org/notes.html
    Searching google for JavaScript callback plugin group:netscape.public.mozilla. Yields some interesting hits.

    There is a good description of the sort of problem that was present between Windows Media Player and Netscape 6.x at http://devedge.netscape.com/viewsource/2001/ms-wmp/ It is unclear whether this problem persists in Netscape 7

    Netscape 6.2 and 7 preview release 1 both say that there might be problems viewing embedded Microsoft Media Players. However, the Netscape 7 final release notes do not have this mentioned? http://wp.netscape.com/eng/mozilla/ns62/relnotes/62.html, http://wp.netscape.com/eng/mozilla/ns7/relnotes/7pv1.html#plugins

    Microsoft has "Using Windows Media Player with Netscape Navigator" http://msdn.microsoft.com/library/default.asp ?url=/library/en-us/wmplay/mmp_sdk/usingwindowsmediaplayerwithnetscapenavigator.asp, which looks Windows Media Player 9 specific.

    However, if I use their example code:

    <HTML>
    <HEAD>
    <TITLE>Netscape test with WNPNS.WMP</TITLE>
    </HEAD>
    <SCRIPT>
    if (navigator.appName == "Netscape") {
      document.writeln('<APPLET NAME="Player" HEIGHT="200" WIDTH="200" CODE="WMPNS.WMP">');
      document.writeln('  <PARAM NAME="URL" VALUE="url.asx"/>');
      document.writeln('</APPLET>');
    } else {
      document.writeln('<OBJECT ID="Player" height="200" width="200"
          (newline here to make this page readable)
          CLASSID="CLSID:6BF52A52-394A-11d3-B153-00C04F79FAA6">');
      document.writeln('  <PARAM name="URL" value="url.asx"/>');
      document.writeln('</OBJECT>');
    }
    </SCRIPT>
    
    Then I get
    Netscape security model is no longer supported.
    Please migrate to the Java 2 security model instead.
    
    
    Netscape security model is no longer supported.
    Please migrate to the Java 2 security model instead.
    
    
    java.lang.NoClassDefFoundError: sun/awt/DrawingSurface
    	at WMPNS.WMP.getHWND(WMP.java)
    	at WMPNS.WMP.start(WMP.java)
    	at sun.applet.AppletPanel.run(AppletPanel.java:370)
    	at java.lang.Thread.run(Thread.java:536)
    
    
    
    I sent Microsoft a message about this problem.

    See ppt/pptindex/README.htm for a possible solution

    You are not logged in 
    ©2002-2009 U.C. Regents